RiverBlogStore
Recent channels
the voices they're s...143its like tweeting bu...for youinformation lived he...textFlix Out of Contextprotagonist100%radical acceptancesky is the limitbottomfeederclotheshit I wantit makes sensePicture in Picture🖤magicrealscaredmelikedmiscfunny textswowretweetspartylikemartydiarysaw this on the inte...Life These DaysCinema:3beingsoundtrack snapshotseverything always mo...connectionsmy turn!non-humansex. power. money.network poetryif u dont laugh u’ll...0016 iphone featured...thoughts to thinkbeautydoesntaskforat...passionMM..FOODit's big out thereBasedrandom things i likehealing timefast poetrymicrohabitatdcyeswhen the light hits ...every day, some new ...Placesheartspotthoughts in the rive...my tweets in hidingi see stars all arou...i ♥️ my lifewalklife in no particula...flashing—lightsa place you end up a...╰(*´︶`*)╯♡plentifulwhat are you up to t...a beverage a dayvisual diaryan absolute snacktulip and tulipspurrwhats cookin good lo...things I see1-uplove in lightsystemstwomatcha~~🍀love is everywherepretty flowersday2datepleasedBlue Skies Green Gra...indastreetsterra firmaIRLnotesI see youPizza Freakinlovecaught.jpegstill liferiver’s treasuresʅ(◞‿◟)ʃliv laf luv
magic
posted by chloee
i ❤️ the Fibonacci sequence
image
1 month ago
magic
posted by chloee
i ❤️ the Fibonacci sequence
image
1 month ago